[Turias]

Has anyone seen this before? My client (running on Linux) spit out the following:

Code:
[12:52:29] Verifying core Core_ca.fah...
[12:52:29] Signature is VALID
[12:52:29] Created: Wednesday April 10, 2002 00:01:22 UTC
[12:52:29] Signed: Monday March 3, 2003 00:18:10 UTC
[12:52:29] 
[12:52:29] Trying to unzip core FahCore_ca.exe
[12:52:29] Decompressed FahCore_ca.exe (2057360 bytes) successfully
[12:52:29] + Core successfully engaged
[12:52:35] 
[12:52:35] + Processing work unit
[12:52:35] Core required: FahCore_ca.exe
[12:52:35] Core found.
[12:52:35] Working on Unit 07 [December 2 12:52:35]
[12:52:35] + Working ...
[12:52:35] Folding@home Protein Design Core Version 2.06 (Feb 25, 2003)
[12:52:35] 
[12:52:35] Proj: work/wudata_07
[12:52:35] Finding work files
[12:52:35] sizeof(CORE_PACKET_HDR) = 512
[12:52:35] Checking frame files
[12:52:35] - Couldn't open work/wudata_07.chk
[12:52:35] Starting from initial work packet
[12:52:35] 
[12:52:35] Updating shared core-client information
[12:52:35] - Writing "work/wudata_07.key": (overwrite)successful.
[12:52:35] Key file to update shared file: work/wudata_07.key
[12:52:35]  keyfile: 0 146 200 15 2 1 0 
[12:52:35] Protein: Des2/pdb1ch4.39.spa
[12:52:35] - Frames Completed: 0, Remaining: 600
[12:52:35] - Dynamic steps required: 120000
[12:52:35] 
[12:52:36] Printed current.prm
[12:52:36] Writing local files:
[12:52:36] - Writing "work/wudata_07.key": (overwrite)successful.
[12:52:36] - Writing "work/wudata_07.xyz": (overwrite)successful.
[12:52:37] - Writing "work/wudata_07.prm": (overwrite)successful.
[12:52:37] Starting design engine
[12:52:37] [SPG] project name: work/wudata_07.
[12:52:37] [SPG]   1  0                                                
[12:52:37] [SPG] Initializing protein design engine                    
[12:52:37] [SPG] seed =            0                                   
[12:52:37] [SPG] Initialization complete                               
[12:52:37] [SPG] Writing current.pdb, chainlength = 146                
[12:52:37] [SPG] Writing current.xyz                                   
[12:52:38] [SPG] Preprocessing . . .                                   
[12:52:38] [SPG]   146 positions in protein                            
[13:00:53] [SPG] Preprocessing complete                                
[13:00:53] Iterations: 0 of 600
[13:00:54] Finished
[13:00:54] [SPG] Native chi angles stored                              
[13:00:55] [SPG] Rotamers read                                         
[13:00:55] [SPG] Starting genetic algorithm                            
[13:03:13] [SPG] seed:              132                                
[13:03:13] [SPG] Designing protein sequence  1 of 30                   
[13:09:27] [SPG]  10.0 % 
[13:15:33] [SPG]  20.0 % 
[13:27:00] [SPG]  30.0 % 
[13:46:31] [SPG]  40.0 % 
[14:10:13] [SPG]  50.0 % 
[14:17:53] [SPG]  60.0 % 
[14:36:28] [SPG]  70.0 %
[14:42:16] [SPG]  80.0 % 
[14:48:05] [SPG]  90.0 % 
[14:53:56] [SPG] 100.0 % 
[14:53:56] [SPG] Writing current.xyz                                   
[14:53:56] [SPG] Sequence  1 completed:                                
[14:53:56] VTMETTYSKEISKLJJRIKFJKVGLEAMAQVLMSYETYKRYLERAGSZES . . .    
[14:53:57] Iterations: 20 of 600
[14:53:58] Finished
[14:53:58] [SPG] seed:              264                                
[14:53:58] [SPG] Designing protein sequence  2 of 30                   
[15:01:08] [SPG]  10.0 % 
[15:08:01] [SPG]  20.0 % 
[15:14:37] [SPG]  30.0 % 
[15:21:15] [SPG]  40.0 % 
[15:27:38] [SPG]  50.0 % 
[15:33:31] [SPG]  60.0 % 
[15:39:10] [SPG]  70.0 % 
[15:44:54] [SPG]  80.0 % 
[15:50:34] [SPG]  90.0 % 
[15:56:35] [SPG] 100.0 % 
[15:56:35] [SPG] Writing current.xyz                                   
[15:56:35] [SPG] Sequence  2 completed:                                
[15:56:35] IDLPNEKKKLLQKFLKQVNITDAGMRAMAIVLJNLREMLKYLQELGKLEE . . .    
[15:56:35] Iterations: 40 of 600
[15:56:36] Finished
[15:56:36] [SPG] seed:              396                                
[15:56:36] [SPG] Designing protein sequence  3 of 30

I hadn't seen this before and thought it looked interesting. Seems like the client is actually designing a protein instead of trying to see how one folds...

[reader50]

FahCore_ca is the Genome core. It is available on x86, but they have been foot dragging about compiling it for Mac.

If I remember correctly, the FahCore_ca source code is in Fortran, and they have had compile problems with Mac Fortran compilers.